PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR11G05260.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family B3
Protein Properties Length: 438aa    MW: 50115.1 Da    PI: 10.4524
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR11G05260.2genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B350.92.7e-16701511198
                      HHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
               B3  11 lksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                       +  +l++p +f +  ++++++  +++l d++ ++W v+l    ksg++++  GWkeF ++n +++g fvvF + ++sef   v+vf+
  LPERR11G05260.2  70 QSMEILRIPPPFNRYLQNQPTG--MVSLVDRNDNTWIVEL--IYKSGEFFFVHGWKEFIRDNSIETGQFVVFNYAKQSEF--SVTVFK 151
                      445679******9555777766..8***************..888999**************************988888..777775 PP

2B3542.9e-17325416398
                      EE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEE CS
               B3   3 kvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkv 96 
                      ++++ s+v     + +p +f++e+   +++sk+ltl d++g+sW+v++ y   ++   +++GW +F+  n+L+  D++vF+l+++++   +v++
  LPERR11G05260.2 325 QIMMESYVYVGFFMNIPCDFVREYL--PRTSKMLTLWDPQGKSWKVNYVYYSDRSVGSFSGGWGKFAIGNNLEKFDVCVFELIQKDN--IKVHI 414
                      6789999999**************6..46889****************995555556799**********************98544..57887 PP

                      E- CS
               B3  97 fr 98 
                      +r
  LPERR11G05260.2 415 YR 416
                      76 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5086314.38160153IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.7E-2061153IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.29E-2061153IPR015300DNA-binding pseudobarrel domain
CDDcd100171.41E-1462151No hitNo description
SMARTSM010191.1E-1262153IPR003340B3 DNA binding domain
PfamPF023624.4E-1472150IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.109.7E-26315416IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019367.59E-26316416IPR015300DNA-binding pseudobarrel domain
CDDcd100172.17E-24321416No hitNo description
PROSITE profilePS5086313.578323418IPR003340B3 DNA binding domain
SMARTSM010195.8E-17323418IPR003340B3 DNA binding domain
PfamPF023622.1E-15325416IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009909Biological Processregulation of flower development
GO:0010048Biological Processvernalization response
GO:0005654Cellular Componentnucleoplasm
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 438 aa     Download sequence    Send to blast
MGRSRKQEGE RRSVKRSRKQ EGERRSVKRS KNQEGERRGV KRSRRSRSEK EEQRNDALGM  60
SFFRVILTEQ SMEILRIPPP FNRYLQNQPT GMVSLVDRND NTWIVELIYK SGEFFFVHGW  120
KEFIRDNSIE TGQFVVFNYA KQSEFSVTVF KLSGIENTLP NSARVSKKVI IKIESDDVDT  180
DNAATNEERM APPLKESNIN TGKRIIDADS LMEDRAPLKK SSDANVAGSS KRKRGASVGK  240
SKASPTSHNS TKGSSCDMSD EDSKLPKAQP ILMQFQNGDI ARRGLSKGQR QLAVISQRRP  300
VTEGEKDHAL QRAKDFKSKN PFAVQIMMES YVYVGFFMNI PCDFVREYLP RTSKMLTLWD  360
PQGKSWKVNY VYYSDRSVGS FSGGWGKFAI GNNLEKFDVC VFELIQKDNI KVHIYRVVPE  420
ITPHKLRSDR IPLLLAMI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4i1k_A5e-1629641722142B3 domain-containing transcription factor VRN
4i1k_B5e-1629641722142B3 domain-containing transcription factor VRN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12329RRSVKRS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0675711e-139AK067571.1 Oryza sativa Japonica Group cDNA clone:J013108N22, full insert sequence.
GenBankAK1019411e-139AK101941.1 Oryza sativa Japonica Group cDNA clone:J033074I03, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015615373.10.0PREDICTED: B3 domain-containing protein Os11g0197600
SwissprotQ2R9D20.0Y1176_ORYSJ; B3 domain-containing protein Os11g0197600
TrEMBLA0A0D9XQ230.0A0A0D9XQ23_9ORYZ; Uncharacterized protein
STRINGBGIOSGA034352-PA0.0(Oryza sativa Indica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18990.12e-26B3 family protein